DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and C06A1.3

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_496276.1 Gene:C06A1.3 / 174626 WormBaseID:WBGene00007354 Length:364 Species:Caenorhabditis elegans


Alignment Length:319 Identity:131/319 - (41%)
Similarity:187/319 - (58%) Gaps:10/319 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKLLSNGSNKNKTLKFD---EGINL----DQIIAKLKLIGEIGSVVQISV---REIEAVCSRARE 57
            ||....|...::..|||   |...|    |..|.::..:.:..::...:|   .||.::......
 Worm     9 KKGSKEGPKSSEISKFDLAKENPKLAEWMDDCIKRMNSLYKDTNINICNVMTGHEIISIIRMVEA 73

  Fly    58 VLLKQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLA 122
            :.:::..|.|..|||.::||||.||.::.|.|:..|..|:...:.||||||||.|.||.|.||..
 Worm    74 IFMEESNLCEAEAPIKVIGDIHAQYQDMNRLFDLIGRVPEEKLMFLGDYVDRGPQGIEVLILLFC 138

  Fly   123 LKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHG 187
            ||.||..:.||||||||..|:|..||||.||:.:|.:.||..|..|:|.:|::.:|.:.:.|.||
 Worm   139 LKIRYRDRIYLLRGNHETPSVNKIYGFYVECQYKYGIGLWWDFQSCFNRMPMSGLISKRVLCMHG 203

  Fly   188 GLSPHLFSMQQIREIRRPIEIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRF 252
            ||||.|.::..||.|.||.|..:.||:.|:|||||..:..||..:.||:|:.||..||.......
 Worm   204 GLSPELINLDTIRNIPRPCEPLDRGLLIDLLWSDPTNKGEGWFHSIRGISYMFGKGVVEQACKSL 268

  Fly   253 KLNLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRP 311
            :::||.|.||||:||||....|:|||:||.||||.:|.||.|::|:|.:|..:|:...|
 Worm   269 EIDLIIRAHQVVQDGYEMMTGRRLITVFSVPNYCAQFTNAAAVVCLNANLQISFQQMIP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 123/295 (42%)
MPP_superfamily 23..311 CDD:301300 123/294 (42%)
C06A1.3NP_496276.1 MPP_superfamily 37..327 CDD:301300 122/289 (42%)
PP2Ac 59..329 CDD:197547 120/269 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.