DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and Ppp6c

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_598273.2 Gene:Ppp6c / 171121 RGDID:708460 Length:305 Species:Rattus norvegicus


Alignment Length:279 Identity:113/279 - (40%)
Similarity:168/279 - (60%) Gaps:14/279 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 INLD---QIIAKLKLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYL 83
            ::||   :|..:.|.:.|         .:::.:|....::||::..:..:..|:.:.||||||:.
  Rat     4 LDLDKYVEIARQCKYLPE---------NDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFY 59

  Fly    84 NLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYG 148
            :|...|.:.|..||:.|:.:||:||||..|:||.|.||||||::|.:..|||||||...|...||
  Rat    60 DLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYG 124

  Fly   149 FYDECKRRY-TVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESG 212
            |||||:.:| ....||.....::.|.:||:|:|.|.|.||||||.:.::.|||.|.|..|||..|
  Rat   125 FYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKG 189

  Fly   213 LICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLI 277
            ..||::||||: .:..|..:.||....||:.|.:.|:|...|.||||.||:|.:||:|....:|:
  Rat   190 AFCDLVWSDPE-DVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLV 253

  Fly   278 TIFSAPNYCGEFDNAGAMM 296
            |::||||||....|..::|
  Rat   254 TVWSAPNYCYRCGNIASIM 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 113/279 (41%)
MPP_superfamily 23..311 CDD:301300 113/278 (41%)
Ppp6cNP_598273.2 MPP_PP2A_PP4_PP6 5..289 CDD:277360 113/278 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.