DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and PROZ

DIOPT Version :10

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_054231085.1 Gene:PROZ / 8858 HGNCID:9460 Length:470 Species:Homo sapiens


Alignment Length:272 Identity:67/272 - (24%)
Similarity:116/272 - (42%) Gaps:63/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RDCV---TCRCGLINTLYKIVGGQETR---VHQYPWMAVILIYN---RFYCSGSLINDLYVLTAA 140
            :.||   .|.||::.:        |.|   :...||.  :.:.|   :.:|.|.:|.:.:|||.|
Human   233 KQCVPHDQCACGVLTS--------EKRAPDLQDLPWQ--VKLTNSEGKDFCGGVIIRENFVLTTA 287

  Fly   141 HCVEGVPPELITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHH 205
            .|  .:....||:: ...||: |.|.::|:  ::.|.||..|:..:.:|||::|.|..|:.....
Human   288 KC--SLLHRNITVK-TYFNRT-SQDPLMIK--ITHVHVHMRYDADAGENDLSLLELEWPIQCPGA 346

  Fly   206 RLRPICLPVQSYSFDHEL-----GIVAGWGAQREGGFGTD---TLREVDVVVLPQSECRNGTTYR 262
            .| |:|.|.:.:: :|.|     |:::||...     |||   :|....|.::...||       
Human   347 GL-PVCTPEKDFA-EHLLIPRTRGLLSGWARN-----GTDLGNSLTTRPVTLVEGEEC------- 397

  Fly   263 PGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPG----- 322
             ||:.:..:......|....|......|.:.|.  |..|.:.|.|::.       .|..|     
Human   398 -GQVLNVTVTTRTYCERSSVAAMHWMDGSVVTR--EHRGSWFLTGVLG-------SQPVGGQAHM 452

  Fly   323 -VYTRVNQYLRW 333
             :.|:|::|..|
Human   453 VLVTKVSRYSLW 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 101..334 CDD:238113 62/253 (25%)
PROZXP_054231085.1 GLA 92..156 CDD:214503
EGF_CA <165..193 CDD:238011
FXa_inhibition 206..235 CDD:464251 0/1 (0%)
Trypsin 259..>411 CDD:459667 46/174 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.