DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and PRSS27

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:271 Identity:93/271 - (34%)
Similarity:135/271 - (49%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 FPIERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEG 145
            |..:|......||....|.::||||:|:..::||...|......:|.||||.:.:|||||||...
Human    15 FGSQRAKAATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHCFRN 79

  Fly   146 VPPE-----LITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHH 205
            ....     |:..|.|.....|:     :...|.:|:.:.||...:...|:|::.|..|:...::
Human    80 TSETSLYQVLLGARQLVQPGPHA-----MYARVRQVESNPLYQGTASSADVALVELEAPVPFTNY 139

  Fly   206 RLRPICLPVQSYSFDHELGI---VAGWGAQREGGFGTD--TLREVDVVVLPQSECR------NGT 259
            .| |:|||..|..|  |.|:   |.|||:..|.....:  .|:::.|.::...:|.      ...
Human   140 IL-PVCLPDPSVIF--ETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEF 201

  Fly   260 TYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQL-AGIVSWGVGCARPQSPGV 323
            .|:|..|.::|:|||: .||.||||.|||||||....    ||..| ||::|||.||||...|||
Human   202 GYQPKTIKNDMLCAGF-EEGKKDACKGDSGGPLVCLV----GQSWLQAGVISWGEGCARQNRPGV 261

  Fly   324 YTRVNQYLRWL 334
            |.||..:..|:
Human   262 YIRVTAHHNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 87/249 (35%)
Tryp_SPc 101..334 CDD:238113 87/249 (35%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 87/250 (35%)
Tryp_SPc 36..275 CDD:238113 88/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.