DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and TMPRSS5

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:250 Identity:82/250 - (32%)
Similarity:128/250 - (51%) Gaps:17/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVP-PELITLR- 154
            ||......:|||||.....::||.|.:.:..|..|.||::...:|:|||||:.... ..|.:.| 
Human   209 CGARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRV 273

  Fly   155 ---FLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQS 216
               .:.|:....:...:::|.:.    |.||:.::.|.|:|:|||...|:. ...:..:|||.:.
Human   274 HAGLVSHSAVRPHQGALVERIIP----HPLYSAQNHDYDVALLRLQTALNF-SDTVGAVCLPAKE 333

  Fly   217 YSFDHELGI-VAGWG-AQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEG 279
            ..|...... |:||| ......:.:|.|::..|.:.....|.:...| .|.:|..|:||||: :|
Human   334 QHFPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFSTQLCNSSCVY-SGALTPRMLCAGYL-DG 396

  Fly   280 GKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            ..|||.|||||||.....:   .::|.|:||||.|||.|..||||.:|.::|.|:
Human   397 RADACQGDSGGPLVCPDGD---TWRLVGVVSWGRGCAEPNHPGVYAKVAEFLDWI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 79/239 (33%)
Tryp_SPc 101..334 CDD:238113 79/239 (33%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133 2/3 (67%)
Tryp_SPc 217..448 CDD:214473 79/240 (33%)
Tryp_SPc 218..451 CDD:238113 80/240 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.