DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and prss60.1

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:265 Identity:100/265 - (37%)
Similarity:139/265 - (52%) Gaps:31/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGLINTLYKIVGGQETRVHQYPWMAVI--LIYNRFYCSGSLINDLYVLTAAHCVEGVPPELIT-- 152
            |||.....:||||.......:||...:  .||...:|.|||||..:|||||||:    |.:.|  
Zfish    25 CGLAPLNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINSEWVLTAAHCL----PRITTSS 85

  Fly   153 -LRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQS 216
             |.||........:...|.|.||.:.||..||..:.:||:|:|.|:..:...:: :||:||..|:
Zfish    86 LLVFLGKTTQQGVNTYEINRTVSVITVHPSYNNLTNENDIALLHLSSAVTFSNY-IRPVCLAAQN 149

  Fly   217 YSFDHELGI-VAGWGAQREG------GFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAG 274
            ..|.:.... :.|||..:.|      |.    |:|..:.|:|..:|  ......|.:|:||:|||
Zfish   150 SVFPNGTSSWITGWGNIQLGVNLPAPGI----LQETMIPVVPNDQC--NALLGSGSVTNNMICAG 208

  Fly   275 YISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGS--- 336
            .: :||:|.|.||||||:   ..:|...:..:||.|||.|||.|.||||||||:||..|:.|   
Zfish   209 LL-QGGRDTCQGDSGGPM---VSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSWINSIIV 269

  Fly   337 -NTPG 340
             |.||
Zfish   270 QNLPG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 92/244 (38%)
Tryp_SPc 101..334 CDD:238113 92/244 (38%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 92/245 (38%)
Tryp_SPc 34..267 CDD:238113 93/247 (38%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587882
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.