DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and tmprss4a

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_005157547.1 Gene:tmprss4a / 777630 ZFINID:ZDB-GENE-061103-631 Length:458 Species:Danio rerio


Alignment Length:289 Identity:101/289 - (34%)
Similarity:145/289 - (50%) Gaps:30/289 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 TTRRTTTTSSTTSRTTTSRTTVANFPIERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIY 121
            ||:..|..|:.:.|...|..||.:.....|     |||.....:||||::..:..:||...:...
Zfish   185 TTKPQTFQSAVSDRKVCSTGTVISLSCSAD-----CGLSRNQDRIVGGKDADIANWPWQVSLQYS 244

  Fly   122 NRFYCSGSLINDLYVLTAAHCVEGVPPELIT-------LRFLEHNRSHSNDDIVIQRYVSRVKVH 179
            .:..|.|||:...:|:|||||..|...:.::       :.:|....|         .||..:.|:
Zfish   245 GQHTCGGSLVTPNWVVTAAHCFNGDGRKALSRWTVVSGITYLSSTPS---------SYVKEIIVN 300

  Fly   180 ELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELG-IVAGWGAQRE-GGFGTDTL 242
            ..|.|...|.|:.:::|..|:.:...| ||:|||.|:.......| :|.|||...| ||..:..|
Zfish   301 SNYKPAESDFDITMIKLQSPITLSESR-RPVCLPPQNLGLKGGDGLVVTGWGHMAEKGGSLSSML 364

  Fly   243 REVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAG 307
            ::..:.|:..::|.:.|.| ...||..|:||| :..||.|||.|||||||....|    ::.|.|
Zfish   365 QKAQIQVIDSAQCSSPTVY-GSSITPRMICAG-VMAGGVDACQGDSGGPLVHLAD----RWVLVG 423

  Fly   308 IVSWGVGCARPQSPGVYTRVNQYLRWLGS 336
            :||||||||||..|||||.|:|.|.|..|
Zfish   424 VVSWGVGCARPGFPGVYTNVDQMLDWAHS 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 87/241 (36%)
Tryp_SPc 101..334 CDD:238113 87/241 (36%)
tmprss4aXP_005157547.1 LDLa 74..105 CDD:238060
SRCR_2 121..218 CDD:295335 11/37 (30%)
Tryp_SPc 223..449 CDD:214473 87/241 (36%)
Tryp_SPc 224..449 CDD:238113 87/240 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6379
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.