DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and zgc:153968

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:261 Identity:90/261 - (34%)
Similarity:137/261 - (52%) Gaps:27/261 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGLINTLYKIVGGQETRVHQYPWMAVI--LIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLR 154
            ||......:|:|||......:||...|  :......|.|:|||..:||:||.|.:    :|....
Zfish    27 CGRAPLKPRIIGGQTAMAGSWPWQVSIHYIPTGGLLCGGTLINREWVLSAAQCFQ----KLTASN 87

  Fly   155 FLEH-NRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYS 218
            .:.| ....:.|..||....|::..|..|:..:..||:|:|:|:.|:....: ::|:||.....|
Zfish    88 LVVHLGHLSTGDPNVIHNPASQIINHPKYDSATNKNDIALLKLSTPVSFTDY-IKPVCLTASGSS 151

  Fly   219 FDH-ELGIVAGWGAQREGG--FGTDTLREVDVVVLPQSECRN--GTTYRPGQITDNMMCAGYISE 278
            ... .:..:.|||:...||  |.| ||:||.:.|:...:|::  |:.     |||.|:||| .:|
Zfish   152 LGKGAVSWITGWGSINTGGTQFPT-TLQEVKIPVVSNGDCKSAYGSL-----ITDGMICAG-PNE 209

  Fly   279 GGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGS----NTP 339
            |||..|.||.||||.....|   |:..:||.|:|.|||:|::|||:|||::|..|:.|    :.|
Zfish   210 GGKGICMGDGGGPLVHNSSE---QWIQSGIASFGRGCAQPKNPGVFTRVSEYESWIKSQISKDQP 271

  Fly   340 G 340
            |
Zfish   272 G 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 84/240 (35%)
Tryp_SPc 101..334 CDD:238113 84/240 (35%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 84/241 (35%)
Tryp_SPc 36..265 CDD:238113 85/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587765
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.