DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and TMPRSS2

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:263 Identity:80/263 - (30%)
Similarity:130/263 - (49%) Gaps:34/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 CVTCRCGLINTLY-KIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVE------ 144
            |:.|...|.::.. :||||:......:||...:.:.|...|.||:|...:::|||||||      
Human   278 CIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNP 342

  Fly   145 -------GVPPELITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDM 202
                   |:    :...|:.:...:.         |.:|..|..|:.::.:||:|:::|.:||..
Human   343 WHWTAFAGI----LRQSFMFYGAGYQ---------VEKVISHPNYDSKTKNNDIALMKLQKPLTF 394

  Fly   203 RHHRLRPICLPVQSYSFDHE-LGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQI 266
             :..::|:|||........| |..::||||..|.|..::.|....|:::....|.:...| ...|
Human   395 -NDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVY-DNLI 457

  Fly   267 TDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYL 331
            |..|:|||:: :|..|:|.|||||||.|:   :...:.|.|..|||.|||:...||||..|..:.
Human   458 TPAMICAGFL-QGNVDSCQGDSGGPLVTS---KNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFT 518

  Fly   332 RWL 334
            .|:
Human   519 DWI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 76/246 (31%)
Tryp_SPc 101..334 CDD:238113 76/246 (31%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133 2/4 (50%)
Tryp_SPc 292..521 CDD:214473 76/247 (31%)
Tryp_SPc 293..524 CDD:238113 77/248 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8579
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.