DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Prss56

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:348 Identity:106/348 - (30%)
Similarity:156/348 - (44%) Gaps:58/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILLPSTTTTTSTPVVATTSTTTRRTTTTSSTTSRTTTSRTTVANFPIER----------DC---- 87
            :|.|.:.|....|:....|....:..:...|.:.....|:  |.:.|:|          :|    
Mouse    12 LLSPDSQTAHGHPLYTRLSPGALQVLSAQGTQALQAAQRS--AQWAIKRVLMEIQHRLHECQVGP 74

  Fly    88 ----------------VTC---RCGLINTLY---KIVGGQETRVHQYPWMAVILIYNRFYCSGSL 130
                            |.|   ..|:.||..   :||||.......:||:..:.:.....|.|.|
Mouse    75 GRPRPQAPLLQDPPEPVQCGERHQGVANTTRAHGRIVGGSTAPSGAWPWLVRLQLGGLPLCGGVL 139

  Fly   131 INDLYVLTAAHCVEGVPPELI-TLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVL 194
            :...:|||||||..|...||: |:...|..:....:::    .|:|:..|..::|::|.||||::
Mouse   140 VAASWVLTAAHCFAGASNELLWTVMLAEGPQGEQAEEV----QVNRILPHPKFDPQTFHNDLALV 200

  Fly   195 RLNQPLDMRHHRLRPICLPVQSYSFDHELG---IVAGWGAQREGGFGTDTLREVDVVVLPQSECR 256
            :|..|:. .....||||||  ..|.:...|   .:|||||..|.|..::.:||..|.:|....|:
Mouse   201 QLWTPVS-PEGPARPICLP--QGSREPPAGTPCAIAGWGALFEDGPESEAVREARVPLLSADTCQ 262

  Fly   257 NGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPG---QYQLAGIVSWGVGCARP 318
            .  ...||.....|:||||:: ||.|:|.|||||||..:   :||   :..|.|:.|||.||..|
Mouse   263 K--VLGPGLRPSTMLCAGYLA-GGIDSCQGDSGGPLTCS---EPGPRPREVLFGVTSWGDGCGEP 321

  Fly   319 QSPGVYTRVNQYLRWLGSNTPGG 341
            ..|||||||..:..||......|
Mouse   322 GKPGVYTRVTVFKDWLQEQMSAG 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 87/239 (36%)
Tryp_SPc 101..334 CDD:238113 87/239 (36%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 87/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - otm44284
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.