DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and TMPRSS3

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:257 Identity:88/257 - (34%)
Similarity:138/257 - (53%) Gaps:25/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 CVTC--RCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGV-PP 148
            |..|  |.|..:   :||||..:.:.|:||.|.:.......|.||:|..|:::||||||..: .|
Human   204 CTACGHRRGYSS---RIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLP 265

  Fly   149 ELITLRF----LEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRP 209
            :..|::.    |..|.:.|:       .|.::..|..|.|:...||:|:::|..||.. :..::|
Human   266 KSWTIQVGLVSLLDNPAPSH-------LVEKIVYHSKYKPKRLGNDIALMKLAGPLTF-NEMIQP 322

  Fly   210 ICLPVQSYSF-DHELGIVAGWGAQREG-GFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMC 272
            :|||....:| |.::...:||||..:| |..:..|....|.::....|.:...| .|.|:.:|:|
Human   323 VCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVY-GGIISPSMLC 386

  Fly   273 AGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            |||:: ||.|:|.|||||||..   ::...::|.|..|:|:|||....|||||||..:|.|:
Human   387 AGYLT-GGVDSCQGDSGGPLVC---QERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 83/239 (35%)
Tryp_SPc 101..334 CDD:238113 83/239 (35%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133 2/5 (40%)
Tryp_SPc 216..444 CDD:214473 83/240 (35%)
Tryp_SPc 217..447 CDD:238113 84/241 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.