DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and zgc:123295

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:260 Identity:98/260 - (37%)
Similarity:142/260 - (54%) Gaps:21/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGL--INTLYKIVGGQETRVHQYPWMAVIL--IYNRFYCSGSLINDLYVLTAAHCVEGVPPELIT 152
            ||.  :||  ||||||......:||...:.  .|...:|.|||||..:||:||||.:.....::.
Zfish    27 CGRAPLNT--KIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSAAHCFQDSIGTIMV 89

  Fly   153 LRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSY 217
            ...|: ::|.|| ...|.:.|.:|..|..||..|.|||:|:::|:..:....: :.|:||.....
Zfish    90 KLGLQ-SQSGSN-PYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDY-IEPVCLAAAGN 151

  Fly   218 SF-DHELGIVAGWGAQREGGFG-TDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGG 280
            :: ...|..|.|||........ .|.|:||::.::..|:|:..   .||:||.||:|||.:.:||
Zfish   152 TYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRA---YPGEITSNMICAGLLDQGG 213

  Fly   281 KDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL----GSNTPGG 341
            ||:|.||||||:   ......|:..:||||:|.|||.|..||||.||:||..|:    ||:.|.|
Zfish   214 KDSCQGDSGGPM---VSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWITSSTGSSNPPG 275

  Fly   342  341
            Zfish   276  275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 89/236 (38%)
Tryp_SPc 101..334 CDD:238113 88/236 (37%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 89/237 (38%)
Tryp_SPc 36..264 CDD:238113 88/236 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587789
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.