DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and zgc:123217

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:272 Identity:90/272 - (33%)
Similarity:133/272 - (48%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TCRCGL--INTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELI 151
            |..||:  :||  :||||.:.....:||...|...||..|.|:||:..:|:|||||:......:.
Zfish    25 TYECGVAPLNT--RIVGGTDAPAGSWPWQVSIHYNNRHICGGTLIHSQWVMTAAHCIINTNINVW 87

  Fly   152 TLRFLEHNRSHS----ND-DIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPIC 211
            ||......:|.|    |: .:.||..:.    |..:|....:||:::::|:||::...: :||||
Zfish    88 TLYLGRQTQSTSVANPNEVKVGIQSIID----HPSFNNSLLNNDISLMKLSQPVNFSLY-IRPIC 147

  Fly   212 LPVQSYSFDHELGIVA-GWGAQREGGFGTD-------TLREVDVVVLPQSECRNGTTYRP---GQ 265
            |...:..|.:.....| ||     |..|.|       ||::|.:.|:..|.|  .|.|..   ..
Zfish   148 LAANNSIFYNGTSCWATGW-----GNIGKDQALPAPQTLQQVQIPVVANSLC--STEYESVNNAT 205

  Fly   266 ITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWG--VGCARPQSPGVYTRVN 328
            ||..|:|||   :..|..|.||||||.|.   :|...:..|||.|:|  .|||....|.||:||:
Zfish   206 ITPQMICAG---KANKGTCQGDSGGPFQC---KQGSVWIQAGITSYGTSAGCAVGAYPDVYSRVS 264

  Fly   329 QYLRWLGSNTPG 340
            ::..|:..|..|
Zfish   265 EFQSWIKMNVQG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 82/250 (33%)
Tryp_SPc 101..334 CDD:238113 82/250 (33%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 82/251 (33%)
Tryp_SPc 37..273 CDD:238113 83/253 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.