DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Prss21

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:266 Identity:95/266 - (35%)
Similarity:148/266 - (55%) Gaps:23/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVE-GVP 147
            |.|.::..||......:||||.:..:.::||...:.::....|..:|:|..:|||||||.: ...
Mouse    38 EPDLLSGPCGHRTIPSRIVGGDDAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHCFQKDND 102

  Fly   148 PELITLRF--LEHNRSHSNDDIVIQRYVSRVKVHELY-NPR---SFDNDLAVLRLNQPLDMRHHR 206
            |...|::|  |....|..|    :|.|.:|.::.::: :|:   .:.||:|:|:|:.|:...:. 
Mouse   103 PFDWTVQFGELTSRPSLWN----LQAYSNRYQIEDIFLSPKYSEQYPNDIALLKLSSPVTYNNF- 162

  Fly   207 LRPICLPVQSYSFDHELGI-VAGWGA--QREGGFGTDTLREVDVVVLPQSECRNGTTYRPG---Q 265
            ::||||...:|.|::.... |.||||  :.|.....:||:||.|.::..|.| |....:|.   .
Mouse   163 IQPICLLNSTYKFENRTDCWVTGWGAIGEDESLPSPNTLQEVQVAIINNSMC-NHMYKKPDFRTN 226

  Fly   266 ITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQY 330
            |..:|:||| ..|||||||.|||||||  ..|:....||: |:||||:||.||..|||||.::.:
Mouse   227 IWGDMVCAG-TPEGGKDACFGDSGGPL--ACDQDTVWYQV-GVVSWGIGCGRPNRPGVYTNISHH 287

  Fly   331 LRWLGS 336
            ..|:.|
Mouse   288 YNWIQS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 89/245 (36%)
Tryp_SPc 101..334 CDD:238113 89/245 (36%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 89/246 (36%)
Tryp_SPc 55..294 CDD:238113 91/249 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.