DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:106 Identity:50/106 - (47%)
Similarity:64/106 - (60%) Gaps:15/106 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 TLREVDVVVLPQSECRN--GTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQY 303
            ||::..|.|:..|:|.|  |.|     |||||||||.: :||||.|.||||||:   ..:|...:
Zfish    15 TLQQTVVPVVINSDCNNLLGAT-----ITDNMMCAGLL-QGGKDTCQGDSGGPM---VSQQCSVW 70

  Fly   304 QLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGS----NTPG 340
            ..:||:|.|..|.:|..|||||||:||..|:.|    |.||
Zfish    71 VQSGIISKGHDCGQPYEPGVYTRVSQYQNWIMSSINQNLPG 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 45/93 (48%)
Tryp_SPc 101..334 CDD:238113 45/94 (48%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 46/96 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.