DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and zgc:112285

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:305 Identity:89/305 - (29%)
Similarity:142/305 - (46%) Gaps:50/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RTTTTSSTTSRTTTSRTTVANFPIERDCVTCRCGLI----NTLYKIVGGQETRVHQYPWMAVILI 120
            |.:|.:...||....:....::|.:       |||.    ||:.:||.|.|.|.|.:||...:.:
Zfish    21 RASTHAFNPSRLQQHKILHLDWPKD-------CGLAHFKPNTVERIVSGNEARPHSWPWQVSLQV 78

  Fly   121 YNR------FYCSGSLINDLYVLTAAHCVE-GVPPELITLRFL--EHNRSHSNDDIVIQRY--VS 174
            ..|      ..|.|:||:..:|||||||.: |...:..:.|.:  :|....|.   ..:|:  |.
Zfish    79 RPRGSKHYVHVCGGTLIHKNWVLTAAHCFQKGKAEDASSWRIVLGKHQLKRSE---TAERFFPVK 140

  Fly   175 RVKVHELYN---PRSFDNDLAVLRLN---QPLDMRHHRLRPICLPVQSYSFD--HELGIVAGWGA 231
            |:..||.:.   ....|.|:|:::..   ||.:.    :|..|||.:..:.:  |... |.|||.
Zfish   141 RIYRHEHFRYPAHSELDYDIALVKAATDIQPSNF----IRYACLPRKQINLNPGHYCW-VTGWGD 200

  Fly   232 QREGGFG---TDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGY-ISEGGKDACSGDSGGPL 292
            .|.|...   .:.|.:..:.::....||. ..:...::.|:|:|||: .:||...||.|||||||
Zfish   201 TRGGKENVSLAEALNQARLPIIDYKTCRQ-KKFWGDRVRDSMICAGFRDTEGTPAACQGDSGGPL 264

  Fly   293 QTTFDEQPG--QYQLAGIVSWG-VGCARPQSPGVYTRVNQYLRWL 334
            ..    |.|  ::::.||||:| :||.....|.|:||...|:.|:
Zfish   265 LC----QVGRDRWEVHGIVSFGPIGCTVENKPSVFTRTAAYIPWI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 78/258 (30%)
Tryp_SPc 101..334 CDD:238113 78/258 (30%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 78/259 (30%)
Tryp_SPc 59..308 CDD:238113 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.