DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and zgc:100868

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:246 Identity:93/246 - (37%)
Similarity:133/246 - (54%) Gaps:11/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFL 156
            ||......:|||||...|..:||...:......:|.|||||:.::||||||... |.....|.:|
Zfish    28 CGTAPLNSRIVGGQNAPVGAWPWQVSLQRDGSHFCGGSLINNQWILTAAHCFPN-PSTTGLLVYL 91

  Fly   157 EHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPV-QSYSFD 220
            ...:..|.:...:...||.:..|..||..:.|||:.:|:|...:...:: :|||||.. .|..|:
Zfish    92 GLQKLASFESYSMSSAVSNIIKHPNYNSDTEDNDITLLQLASTVSFSNY-IRPICLAASDSTFFN 155

  Fly   221 HELGIVAGWGAQREGGF--GTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKDA 283
            ..|..:.|||....|..  ...||:||.|.::...:|  ...|...:|||||:|||.: :||||:
Zfish   156 GTLVWITGWGNTATGVSLPSPGTLQEVQVPIVGNRKC--NCLYGVSKITDNMVCAGLL-QGGKDS 217

  Fly   284 CSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            |.||||||:   ..:|...:..:||||:|.|||:|..|||||||::|..|:
Zfish   218 CQGDSGGPM---VSKQGSVWIQSGIVSFGTGCAQPNFPGVYTRVSKYQSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 90/235 (38%)
Tryp_SPc 101..334 CDD:238113 90/235 (38%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 90/236 (38%)
Tryp_SPc 37..267 CDD:238113 91/237 (38%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.