DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and zgc:112038

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:251 Identity:91/251 - (36%)
Similarity:133/251 - (52%) Gaps:27/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GGQETRVHQYPWMAVI--LIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLR-----FLEHNR 160
            ||.:.....:||.|.|  :......|.|||||..:||:||||.      :||..     ||....
Zfish    37 GGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCF------MITATANIKIFLGRQF 95

  Fly   161 SHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICL-PVQSYSFDHELG 224
            ...::...|.|.::::.:|..|:..:.:||:|:|||:..:....: :||:|| ...|........
Zfish    96 QTGSNPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDY-IRPVCLASADSVFAGGTKS 159

  Fly   225 IVAGWGAQREGGFG-TDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDS 288
            .:.||...|..... |:.|:||.:.|:..:||  ...|: |.|||||:||| |:|||||||.|||
Zfish   160 WITGWDKHRSSDIQVTNVLQEVQLPVVSNTEC--NADYK-GIITDNMICAG-INEGGKDACQGDS 220

  Fly   289 GGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGS----NTPG 340
            |||:   ..:...::..:||||:|..|..|:.||:||||:||..|:.|    |.||
Zfish   221 GGPM---VSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITSELRTNLPG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 86/238 (36%)
Tryp_SPc 101..334 CDD:238113 86/239 (36%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 86/239 (36%)
Tryp_SPc 37..263 CDD:238113 86/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587783
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.