DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Tmprss2

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_056590.2 Gene:Tmprss2 / 50528 MGIID:1354381 Length:490 Species:Mus musculus


Alignment Length:262 Identity:80/262 - (30%)
Similarity:124/262 - (47%) Gaps:33/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 CVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVE------- 144
            |:.|....:....:||||.......:||...:.:.....|.||:|...:::|||||||       
Mouse   240 CIECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSSPR 304

  Fly   145 ------GVPPELITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMR 203
                  |:..:.:......|.             |.:|..|..|:.::.:||:|:::|..||.. 
Mouse   305 YWTAFAGILRQSLMFYGSRHQ-------------VEKVISHPNYDSKTKNNDIALMKLQTPLAF- 355

  Fly   204 HHRLRPICLPVQSYSFDHELGI-VAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQIT 267
            :..::|:|||......|.:... ::||||..|.|..:|.|....|.::..|:|.:...|. ..||
Mouse   356 NDLVKPVCLPNPGMMLDLDQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYN-NLIT 419

  Fly   268 DNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLR 332
            ..|:|||:: :|..|:|.|||||||.|.   :.|.:.|.|..|||.|||:...||||..|..:..
Mouse   420 PAMICAGFL-QGSVDSCQGDSGGPLVTL---KNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTD 480

  Fly   333 WL 334
            |:
Mouse   481 WI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 77/246 (31%)
Tryp_SPc 101..334 CDD:238113 77/246 (31%)
Tmprss2NP_056590.2 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:373897 2/6 (33%)
Tryp_SPc 254..485 CDD:238113 78/248 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11120
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.