DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and cela1.2

DIOPT Version :10

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001011493.1 Gene:cela1.2 / 496993 XenbaseID:XB-GENE-5739190 Length:265 Species:Xenopus tropicalis


Alignment Length:54 Identity:13/54 - (24%)
Similarity:18/54 - (33%) Gaps:13/54 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   658 INVMNKTAKVCMVGSDLRKLAITHIINDSNNQRLMLGDSSMLPVAGTKAGLKPQ 711
            :...||..:.|.:  |..|...|..:....|:.|           ..||||..|
 Frog    18 LGTYNKLTETCFL--DCVKDFTTREVKPEENEAL-----------AAKAGLLGQ 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 101..334 CDD:238113
cela1.2NP_001011493.1 Tryp_SPc 29..264 CDD:238113 10/43 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.