DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and cela3a

DIOPT Version :10

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001011426.1 Gene:cela3a / 496909 XenbaseID:XB-GENE-996869 Length:275 Species:Xenopus tropicalis


Alignment Length:145 Identity:29/145 - (20%)
Similarity:52/145 - (35%) Gaps:49/145 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 AVYFILYHLFVTLIVLSLFVAV---------------ILDNL---------ELDE---DIKKLKQ 573
            |:..||..:.:.|:::.||.|:               |.||:         |.|.   ||..|:.
 Frog    19 ALIAILLCIIILLVIVVLFAALKRQRKKEPLILSKEDIRDNIVSYNDEGGGEEDTQAFDIGTLRN 83

  Fly   574 LKFREQSAEIKETLPFRLRIFEKFPDSPQMAILHKIPNDFTLPKVRESFMKQFVLE-MEPEDLEG 637
            ....|:....::.:|..|.|..:.|.:|.                 .:.::.|:.| ::..||: 
 Frog    84 PAAIEEKKLRRDIIPETLFIPRRTPTAPD-----------------NTDVRDFINERLKEHDLD- 130

  Fly   638 YQRPMPECWDSRIAY 652
               |....:||...|
 Frog   131 ---PTAPPYDSLATY 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 101..334 CDD:238113
cela3aNP_001011426.1 Tryp_SPc 28..265 CDD:238113 26/136 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.