DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG11836

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:260 Identity:107/260 - (41%)
Similarity:160/260 - (61%) Gaps:9/260 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPE 149
            ::| .|.||..|...:||||:.|.|:||||||.|:...:|:|.|||:...|||:|||||:.:...
  Fly    82 KNC-DCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKS 145

  Fly   150 LITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPV 214
            .|.:.|.:|::..:::...|||.|:.|..|:.::|.:::||:|:|||.:|:.. ...::|||||.
  Fly   146 KIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISF-SKIIKPICLPR 209

  Fly   215 QSYSFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEG 279
            .:|.....:|.|.|||...|||.....:.:|.|.::..:|||| ..|:..:||.:|:|||..|  
  Fly   210 YNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRN-QRYKSTRITSSMLCAGRPS-- 271

  Fly   280 GKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSNTPGGCHC 344
             .|:|.|||||||..:   ...:|.:.|||||||||.|...||||:||::::.|:.||....|.|
  Fly   272 -MDSCQGDSGGPLLLS---NGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLENTCLC 332

  Fly   345  344
              Fly   333  332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 97/232 (42%)
Tryp_SPc 101..334 CDD:238113 97/232 (42%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 98/235 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471771
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
99.000

Return to query results.
Submit another query.