DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG7432

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:345 Identity:111/345 - (32%)
Similarity:166/345 - (48%) Gaps:69/345 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PSTTTTTSTPVVATTSTTTRRTTTTSS-----------TTSRTTTSRT--------TVANFPIER 85
            |:|||:|:.....|..:|.|.||..:|           ||:.|||:..        .:.|..::.
  Fly   398 PTTTTSTTKATQPTKKSTVRPTTRPTSGLVLIPQKKPPTTTTTTTTEVPLEPEGLDEIGNNIVDP 462

  Fly    86 DCVTCRCGLIN-TLYKIVGGQETRVHQYPWMAVILIY----NRFYCSGSLINDLYVLTAAHCV-- 143
            |    .||... :..:||||.|....|:||||.|.::    ..|:|.||||...|:||||||.  
  Fly   463 D----ECGQQEYSTGRIVGGVEAPNGQWPWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRD 523

  Fly   144 ---EGVPPELITLRFLEHNRS---HSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDM 202
               :.......|:|..:.:.|   ..:|.:...  |..|:.||.::...|.||:|:|.|::|:..
  Fly   524 SRQKPFAARQFTVRLGDIDLSTDAEPSDPVTFA--VKEVRTHERFSRIGFYNDIAILVLDKPVRK 586

  Fly   203 RHHRLRPICLPVQSYSFDHELGI--------------VAGWGAQREGGFGTDTLREVDVVVLPQS 253
            ..:.: |:|||         .||              |.|||....||..:.:.|:.::.:....
  Fly   587 SKYVI-PVCLP---------KGIRMPPKERLPGRRATVVGWGTTYYGGKESTSQRQAELPIWRNE 641

  Fly   254 ECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARP 318
            :| :.:.::|  |.:|.:|||| |:||.|||.|||||||...:|   ..:...|:||:|..|..|
  Fly   642 DC-DRSYFQP--INENFICAGY-SDGGVDACQGDSGGPLMMRYD---SHWVQLGVVSFGNKCGEP 699

  Fly   319 QSPGVYTRVNQYLRWLGSNT 338
            ..|||||||.:||.|:..:|
  Fly   700 GYPGVYTRVTEYLDWIRDHT 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 89/258 (34%)
Tryp_SPc 101..334 CDD:238113 89/258 (34%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 89/259 (34%)
Tryp_SPc 475..718 CDD:238113 90/261 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.