DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG31266

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:249 Identity:74/249 - (29%)
Similarity:110/249 - (44%) Gaps:26/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KIVGGQETRVHQYPWMAVIL-IYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRSHS 163
            :::||.......:||:|.|. .|:...|...::::.:|||||.||.|:.|    |..|....:..
  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRP----LNLLVVTGTVD 111

  Fly   164 NDDIVIQRY-VSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGIVA 227
            ..|:....| ||::.||..::...:.||:|:|:|:..::............:.......:| ..|
  Fly   112 WWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKL-TFA 175

  Fly   228 GWGAQREGGFGTDTLREVDVVVLPQSECR----NGTTYRPGQITDNMMCAGYISEGGKDACSGDS 288
            |||:....|.....|:|.....||...||    |......|.:...|       :.|:.||.||:
  Fly   176 GWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQM-------DAGQGACHGDT 233

  Fly   289 GGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSNTPGGC 342
            ||||   .||   |.:|.||.:|||.|.|.. |.||.|...|..|: ..|..||
  Fly   234 GGPL---IDE---QQRLVGIGNWGVPCGRGY-PDVYARTAFYHDWI-RTTMNGC 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 70/238 (29%)
Tryp_SPc 101..334 CDD:238113 70/238 (29%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 70/239 (29%)
Tryp_SPc 52..275 CDD:238113 71/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.