DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG14892

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:439 Identity:99/439 - (22%)
Similarity:154/439 - (35%) Gaps:155/439 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LPSTTTTTSTPVVATTSTTTRRTTTTSSTTSRTTTSRTTVAN---------FPIERDCVT-CRCG 93
            |.|.:.|.|.|.....|....|:.:.|.:........|:.|.         .|..|...| |.|.
  Fly     9 LHSQSQTQSRPKSRLQSRPQSRSQSLSQSQCHWQIPATSTATLSWLCLLLLLPSSRQFETDCGCR 73

  Fly    94 LINTLYKIVGGQETRVHQYPWMAVI------LIYNRFYCSGSLINDLYVLTAAHCVEG------V 146
            ......:|:.|..|...|:||.|.:      |.:...:|...||:..::|:|||||..      :
  Fly    74 PARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPI 138

  Fly   147 PPELITLRFLEHNRS-HSNDDIVIQRY-VSRVKVHELYNPRSFDNDLAVLRLNQPLDM-RHHRLR 208
            || |.|:...||:|. .|.::   ||. |.::.:|..|:  :|.:|:.:::|::|.|: |...:|
  Fly   139 PP-LWTVVLGEHDRDVESGNE---QRIPVEKIVMHHRYH--NFKHDVVLMKLSKPADLTRASNIR 197

  Fly   209 PICLP--------------------------VQSYSFDH-------------------------- 221
            .||||                          :|....:.                          
  Fly   198 RICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSM 262

  Fly   222 -----------------------------------ELG--------------------------- 224
                                               :||                           
  Fly   263 KELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVD 327

  Fly   225 -IVAGWGAQREGGFGTDTLREVDVVVLPQSECRN--GTTYRPGQITDNMMCAGYIS-EGGKDACS 285
             :..|||.....|..::.|.:..|.:.....||:  |:..   .|....:|||.:: |||  .|.
  Fly   328 CVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDAYGSFV---NIHGGHLCAGKLNGEGG--TCV 387

  Fly   286 GDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            ||||||||... .:.|.:.|.|:.|:|.|||....|.||||.:.|::|:
  Fly   388 GDSGGPLQCRL-SRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWI 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 83/365 (23%)
Tryp_SPc 101..334 CDD:238113 83/365 (23%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 83/366 (23%)
Tryp_SPc 81..438 CDD:238113 84/367 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.