DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Sb

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:391 Identity:122/391 - (31%)
Similarity:182/391 - (46%) Gaps:99/391 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 WLGSILLPSTTTTTSTPVVATTSTTTRRTTTTSSTTSRTTTSRTT-------------------- 77
            |..|    :|:||:||....||:||||||||.::||.||||::.|                    
  Fly   402 WPSS----TTSTTSSTTSTTTTTTTTRRTTTPTTTTRRTTTNKPTRPYQRPTTATSSSSTSTTSS 462

  Fly    78 -----------------------------------VANFPIERDCVT------------------ 89
                                               :|...||.:.::                  
  Fly   463 KTPTTTRPISSSSSSSSGIVTSSQRPTQPTHRTPVLATSGIETNEISDSSIPDAGALGHVKTISA 527

  Fly    90 --CRCGLINTL----YKIVGGQETRVHQYPWMAVILIYNRF------YCSGSLINDLYVLTAAHC 142
              ..|| :.||    .:||||:.....::||...:...:.|      .|.|:|||:.::.||.||
  Fly   528 ARSECG-VPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHC 591

  Fly   143 VEGVPPELITLRFLEHNRSHSNDDI-VIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHR 206
            |:.:....|.:|..|::.||..:.: .|:|.|::..||..|:..:::.|||:::|.|||:...| 
  Fly   592 VDDLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPH- 655

  Fly   207 LRPICLPVQSYSFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQ---ITD 268
            :.|||||............|.|||...|||.....|:||.|.::....|:: ...|.|:   |.|
  Fly   656 VSPICLPETDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKS-MFMRAGRQEFIPD 719

  Fly   269 NMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRW 333
            ..:|||| ..||:|:|.||||||||.  ..|.|::.||||:|||:|||....|||.||::::..|
  Fly   720 IFLCAGY-ETGGQDSCQGDSGGPLQA--KSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPW 781

  Fly   334 L 334
            :
  Fly   782 I 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 90/242 (37%)
Tryp_SPc 101..334 CDD:238113 90/242 (37%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 90/243 (37%)
Tryp_SPc 544..785 CDD:238113 91/244 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.