DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG3916

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:261 Identity:76/261 - (29%)
Similarity:121/261 - (46%) Gaps:59/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KIVGGQETRVHQ-YPWMAVILIYNR----FYCSGSLINDLYVLTAAHCVEGVPPELI-----TLR 154
            :|.|||  ||:: .|:...:.:..|    .:|.||:::..:|||||||:|.:..|.:     ||.
  Fly    30 RINGGQ--RVNETVPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVGTLN 92

  Fly   155 FLEHNRSHSNDDIVIQRYVSRVKVHELY--NPRSFDNDLAVLRLNQPLDMRHHRLRPICL----- 212
            :......|        |.|:: .||..|  |||.. ||:|::::..|..:....:..|.:     
  Fly    93 WKAGGLRH--------RLVTK-HVHPQYSMNPRII-NDIALVKVTPPFRLERSDISTILIGGSDR 147

  Fly   213 -----PVQSYSFDHELGIVAGWGAQREGGFGT---DTLREVDVVVLPQSECRNGTTYRPGQITDN 269
                 ||:          :.|||:........   |.|:.::...:...:| |...:|   :|.|
  Fly   148 IGEKVPVR----------LTGWGSTSPSTSSATLPDQLQALNYRTISNEDC-NQKGFR---VTRN 198

  Fly   270 MMCAGYISEGGKDACSGDSGGPLQTTFDEQPG-QYQLAGIVSWGVGCARPQSPGVYTRVNQYLRW 333
            .:||  ::..|:.||.|||||||     .:|| |..|.||||:|........|.|||||:.:|.:
  Fly   199 EICA--LAVQGQGACVGDSGGPL-----IRPGKQPHLVGIVSYGSSTCAQGRPDVYTRVSSFLPY 256

  Fly   334 L 334
            :
  Fly   257 I 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 76/258 (29%)
Tryp_SPc 101..334 CDD:238113 76/258 (29%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 76/259 (29%)
Tryp_SPc 31..260 CDD:238113 76/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.