DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG17404

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:264 Identity:82/264 - (31%)
Similarity:115/264 - (43%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 TLYKIVGGQETRVHQYPWMAVILIY-----NRFYCSGSLINDLYVLTAAHCVEGVPPELIT---- 152
            |.::||||.:....::....|.|.|     ...:|.||:|....:||||||.:|:....::    
  Fly    31 TPHRIVGGADIPPGEHVPYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQGLNASRMSVVAG 95

  Fly   153 LRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSY 217
            :|.|....|.|.    :..|....|..||..     :|||||.:..||.:.:..:..|....|..
  Fly    96 IRGLNEKGSRSQ----VLSYSIHPKYQELVT-----SDLAVLSIKPPLKLNNSTISAIEYRSQGK 151

  Fly   218 SFDHELG-----IVAGWGAQREGGFG-------TDTLREVDVVVLPQSECRNGTTYRPGQITDNM 270
            .|   :|     .:.|||.:....|.       .:.|:.:....:..|||||...   ..:||..
  Fly   152 DF---VGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNAGM---ESVTDTE 210

  Fly   271 MCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWG-VGCARPQSPGVYTRVNQYLRWL 334
            :||.....|   ||||||||||..   |.....|..||||:| |.|....||.|||||:.:..|:
  Fly   211 ICARGPFRG---ACSGDSGGPLVM---ESKNGLQQVGIVSYGLVVCGLYISPDVYTRVSTFSDWI 269

  Fly   335 GSNT 338
            |:.|
  Fly   270 GNQT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 78/254 (31%)
Tryp_SPc 101..334 CDD:238113 78/254 (31%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 78/255 (31%)
Tryp_SPc 35..269 CDD:238113 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.