DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:244 Identity:90/244 - (36%)
Similarity:134/244 - (54%) Gaps:16/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 YKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHC-VEGVPPE--LITLRFLEHNR 160
            :|:.|||:....::||.|.:...|...|..:||::.:::||||| |....|:  .::..||....
  Rat   185 HKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCFVRSANPKDWKVSFGFLLSKP 249

  Fly   161 SHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELG- 224
            .       .||.|..:.:||.|:..:.:||:||:||:.|: :..:.:|..|||..:..|..... 
  Rat   250 Q-------AQRAVKSIVIHENYSYPAHNNDIAVVRLSSPV-LYENNIRRACLPEATQKFPPNSDV 306

  Fly   225 IVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSG 289
            :|.|||..:..|...:.|::..|.::....|.:|..| .|.||..|:|||:: ||..|||.||||
  Rat   307 VVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAY-GGVITPGMLCAGFL-EGRVDACQGDSG 369

  Fly   290 GPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSNT 338
            |||.:  ::..|.:.||||||||..||.|..|||||||..|..|:.|.|
  Rat   370 GPLVS--EDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISSKT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 87/236 (37%)
Tryp_SPc 101..334 CDD:238113 86/236 (36%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 87/237 (37%)
Tryp_SPc 187..415 CDD:238113 87/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.