DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG9372

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:295 Identity:102/295 - (34%)
Similarity:162/295 - (54%) Gaps:17/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TSTPVVATTSTTTRRTTTTSSTTSRTTTSRTTVANFPIERDC-VTCRCGLINTLYKIVGGQETRV 109
            :|..:..|..:|:.|.:....|::.....|  :.|.|.:|.| :|.|     ...::.||:....
  Fly   125 SSIGICCTDQSTSNRFSPQVVTSADGDEPR--IVNKPEQRGCGITSR-----QFPRLTGGRPAEP 182

  Fly   110 HQYPWMAVILIYNR--FYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRSHSNDDIVIQRY 172
            .::||||.:|....  .:|.|.||.|.:|||||||:.....|.|.:|..|:|....|:.......
  Fly   183 DEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRARDFR 247

  Fly   173 VSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGIVAGWGAQREGGF 237
            ::.:.:|..|||:::|||:|::|:::......: :.|:|:|..:..:.....||.|||.|:.||.
  Fly   248 IANMVLHIDYNPQNYDNDIAIVRIDRATIFNTY-IWPVCMPPVNEDWSDRNAIVTGWGTQKFGGP 311

  Fly   238 GTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQ 302
            .::.|.||::.|..||:||:....   .:.|..||||: .|||:|:|.|||||||......|  :
  Fly   312 HSNILMEVNLPVWKQSDCRSSFVQ---HVPDTAMCAGF-PEGGQDSCQGDSGGPLLVQLPNQ--R 370

  Fly   303 YQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSN 337
            :...|||||||||.:...||:||||::||.|:.:|
  Fly   371 WVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWILAN 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 88/234 (38%)
Tryp_SPc 101..334 CDD:238113 88/234 (38%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 1/6 (17%)
Tryp_SPc 173..402 CDD:214473 88/235 (37%)
Tryp_SPc 176..402 CDD:238113 88/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457744
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
65.890

Return to query results.
Submit another query.