DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG4914

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:370 Identity:144/370 - (38%)
Similarity:194/370 - (52%) Gaps:61/370 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LGSILL--PSTTTTTSTPVVATTSTTTRRTTTTSSTTS--------------------RTTTSRT 76
            :.|.||  .:|:.|.:||....||.....:|.|||.:|                    ....:.:
  Fly    15 MASCLLFTAATSATPATPATPATSAPPATSTATSSLSSIPGKYQALGAAHHQAKKLKIGDVNASS 79

  Fly    77 TVANFPIERD-------------------------CVTCRCGLINTLYKIVGGQETRVHQYPWMA 116
            :.||.|:.|.                         | :||||..|...:||||..|.|.:|||||
  Fly    80 SDANKPVFRQNPIKNWFGAFNRNNSPAAQNQTSPTC-SCRCGERNDESRIVGGTTTGVSEYPWMA 143

  Fly   117 VILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRSHSNDDIVIQRYVSRVKVHEL 181
            .:..:|||||.|:||||.|||||||||:|....:|.:.|.||:|.:..:. ...|:|.|. ..:.
  Fly   144 RLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCNDKER-PETRFVLRA-FSQK 206

  Fly   182 YNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELG---IVAGWGAQREGGFGTDTLR 243
            ::..:||||:|:||||..:.:... :||||||......|..:|   |..|||..:|.|..:..|:
  Fly   207 FSFSNFDNDIALLRLNDRVPITSF-IRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQ 270

  Fly   244 EVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPL-QTTFDEQPGQYQLAG 307
            ||:|.||...||...|.|....||.||||:||...||:|:|.||||||| :...|::  :::..|
  Fly   271 EVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDK--RFEQIG 333

  Fly   308 IVSWGVGCARPQSPGVYTRVNQYLRWLGSNTPGGCHCMPYPEEDY 352
            |||||.|||||..|||||||.:||.|:..|:..||.|    :|||
  Fly   334 IVSWGNGCARPNYPGVYTRVTKYLDWIVENSRDGCFC----DEDY 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 112/236 (47%)
Tryp_SPc 101..334 CDD:238113 112/236 (47%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 112/237 (47%)
Tryp_SPc 128..363 CDD:238113 113/239 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
88.070

Return to query results.
Submit another query.