DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG6462

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:345 Identity:89/345 - (25%)
Similarity:133/345 - (38%) Gaps:85/345 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILLPSTTTTTSTPVVATTSTTTRRTTTTSSTTSRT------TTSRTTVANFPIERDCVTCRCGLI 95
            :||.||...:|.|.:.|.......|..........      ...|.....|.:|.:    :...:
  Fly    13 LLLSSTLVKSSEPWLDTFEHPKEETPDDDDAIMERRWQLGYENFRLRCEKFEMEGN----QTAAV 73

  Fly    96 NTLYKIVGGQETRVHQYPWMAVILIY----NRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFL 156
            .|  :|.||:......:|:...::|.    :...|.||||...:|||||||:             
  Fly    74 RT--RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCL------------- 123

  Fly   157 EHNRSHSNDDIVIQRYVSRV-------KVHEL-YNPRSF-----------DNDLAVLRLNQPLDM 202
                   .|.|..:.|....       .|.|| ...|.|           .:|||::||  |..:
  Fly   124 -------TDAIAAKIYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRL--PRKV 179

  Fly   203 R-HHRLRPICLPVQSYSFDHELGIV------AGWGAQREGGFGTD----TLREVDVVVLPQSECR 256
            | ..:::||.|   :..|.|:..:|      :|||..   |..||    .|:.:|..|:.|..|.
  Fly   180 RTSEQVQPIEL---AGEFMHQNFLVGKVVTLSGWGYL---GDSTDKRTRLLQYLDAEVIDQERCI 238

  Fly   257 NGTTYRPGQITDNM-MCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWG--VGCARP 318
              ..:.||.::... :|..  ...|:.||:||||||:  .:..:...| |.|:.|:|  .|| ..
  Fly   239 --CYFLPGLVSQRRHLCTD--GSNGRGACNGDSGGPV--VYHWRNVSY-LIGVTSFGSAEGC-EV 295

  Fly   319 QSPGVYTRVNQYLRWLGSNT 338
            ..|.||||:..||.|:...|
  Fly   296 GGPTVYTRITAYLPWIRQQT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 75/269 (28%)
Tryp_SPc 101..334 CDD:238113 75/269 (28%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 75/270 (28%)
Tryp_SPc 77..314 CDD:238113 76/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457790
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.