DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG14990

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:282 Identity:81/282 - (28%)
Similarity:138/282 - (48%) Gaps:40/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 VANFPIERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHC 142
            |||..:.:|            |...|       |:||:..:....:::.:||||....|||||..
  Fly    57 VANVKVPKD------------YSTPG-------QFPWVVALFSQGKYFGAGSLIAPEVVLTAASI 102

  Fly   143 VEGVPPELITLRFLEHNRSHSNDDIVIQ-RYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHR 206
            |.|.....|.:|..|.|....::.:..: |.|:||..|..::.....|::|:|.|..|.:::.| 
  Fly   103 VVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSH- 166

  Fly   207 LRPICLPVQSYSFDHELGIVAGWG--AQREGGFGTDTLREVDVVVLPQSEC-------RNGTTYR 262
            :|.||||.|..|||.:..:|.|||  |..:..: ::..:::::.::.:::|       |.|.:: 
  Fly   167 IRTICLPSQGRSFDQKRCLVTGWGKVAFNDENY-SNIQKKIELPMINRAQCQDQLRNTRLGVSF- 229

  Fly   263 PGQITDNMMCAGYISEGGKDA--CSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYT 325
              .:..:::|||    |.|||  |.||.|..|....:..|.:|:.||||:||:||.....|.|||
  Fly   230 --DLPASLICAG----GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYT 288

  Fly   326 RVNQYLRWLGSNTPGGCHCMPY 347
            .|..:..|:..:.....:.:|:
  Fly   289 NVEMFRDWIYEHMAQNSNSVPF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 74/244 (30%)
Tryp_SPc 101..334 CDD:238113 74/244 (30%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 75/248 (30%)
Tryp_SPc 67..297 CDD:214473 74/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.