DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and KLKB1

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:263 Identity:97/263 - (36%)
Similarity:143/263 - (54%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 CVTCRCGLINTLYKIVGGQETRVHQYPW---MAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPP 148
            |.|      .|..:||||..:...::||   :.|.|...|..|.||||...:|||||||.:|:|.
Human   394 CTT------KTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPL 452

  Fly   149 ELITLRFLEHNRSHSN----DDIVIQRYVSRVK---VHELYNPRSFDNDLAVLRLNQPLDMRHHR 206
            :.:.       |.:|.    .||......|::|   :|:.|.....::|:|:::|..||:....:
Human   453 QDVW-------RIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQ 510

  Fly   207 LRPICLPVQ-SYSFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNM 270
             :|||||.: ..|..:....|.|||..:|.|...:.|::|::.::...||:.  .|:..:||..|
Human   511 -KPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQK--RYQDYKITQRM 572

  Fly   271 MCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLG 335
            :|||| .|||||||.|||||||..   :..|.::|.||.|||.||||.:.|||||:|.:|:.|:.
Human   573 VCAGY-KEGGKDACKGDSGGPLVC---KHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWIL 633

  Fly   336 SNT 338
            ..|
Human   634 EKT 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 92/243 (38%)
Tryp_SPc 101..334 CDD:238113 92/243 (38%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 401..632 CDD:214473 92/244 (38%)
Tryp_SPc 402..632 CDD:238113 92/243 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.