DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG30414

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:292 Identity:81/292 - (27%)
Similarity:116/292 - (39%) Gaps:80/292 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGLINTLY--KIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEG--------- 145
            ||.....:  .|.||.:..:...|||..:|  ....|.||||...:|||||||:..         
  Fly    30 CGTTKPEFIPMITGGADAGLFSNPWMVKVL--GEKLCGGSLITSRFVLTAAHCIVSTHMRVRLGE 92

  Fly   146 -------------VPP--ELITLRFLEHN-RSHSNDDIVIQRY---VSRVKVHELYNPRSFDNDL 191
                         ||.  :|..:|..|:: |....|..|.:.|   |.|..:|..|| .:.|||:
  Fly    93 YKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYN-LNLDNDI 156

  Fly   192 AVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECR 256
            .:||:...:....: :|||||.|:.:..:..:..:.|||...:|              .|....:
  Fly   157 GLLRMKSFVQYSDY-VRPICLLVEGHMAESPIFNITGWGVTNDG--------------TPSRRLQ 206

  Fly   257 NGTTYRPG----------QITDNMMCAGYISEGGKDACSGDSGGPLQT---------TFDEQPGQ 302
            ..|.|...          |:.::.:||   :....|||.|||||||..         ||     |
  Fly   207 RATVYNTDLHFCRSKFTKQVDESQICA---AGTNSDACHGDSGGPLSAQVPFAGSWLTF-----Q 263

  Fly   303 YQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            |   |:||:  |.|...|..|||.|..:..|:
  Fly   264 Y---GLVSY--GSAACHSFSVYTNVTHHRDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 78/279 (28%)
Tryp_SPc 101..334 CDD:238113 78/279 (28%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 78/279 (28%)
Tryp_SPc 41..290 CDD:238113 78/279 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.