DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG13744

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:259 Identity:88/259 - (33%)
Similarity:131/259 - (50%) Gaps:22/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGL----INTLYK-IVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELI 151
            ||:    .|||.| |:||:..:..:|||.|.|.| ..:.|.|.||:...|.|||||::......|
  Fly   128 CGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHCIQQAHLADI 191

  Fly   152 TLRFLE---HNRSHSNDDIVIQRY-VSRVKVHELYNPRSFD---NDLAVLRLNQPLDMRHHRLRP 209
            |:...|   .:..|.::.:.:::: |.:..:|..:|.|...   .|:|:|:|.||.....|.| |
  Fly   192 TVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHIL-P 255

  Fly   210 ICLPVQSYSFDHELGIVAGWGAQRE--GGFGTDTLREVDVVVLPQSECRNGTTYRP--GQITDNM 270
            ||||..........|::||||....  |..||:.|:...|.::...:|......:.  .:|...|
  Fly   256 ICLPQYPIRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINVEIKAEM 320

  Fly   271 MCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            .|||: |:|..|||.|||||||..   ::.|::.|.||.|.|.||.....||:|..|.:.:||:
  Fly   321 FCAGH-SDGHMDACLGDSGGPLVI---KERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 81/244 (33%)
Tryp_SPc 101..334 CDD:238113 81/243 (33%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 81/244 (33%)
Tryp_SPc 142..383 CDD:238113 82/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.