DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and flz

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:372 Identity:122/372 - (32%)
Similarity:162/372 - (43%) Gaps:85/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 STTT----TTSTPVVATTSTTTRRTTT------TSSTTSRTTTSRTTVANFPI-----ERD---- 86
            ||||    |..|.|.|..:|||||..|      .|||...||.|....|:..|     |.|    
  Fly  1330 STTTRKPATRRTTVAAKVTTTTRRPATKKPTRRVSSTVKTTTVSSARPADDEIVDEEDEEDVNPN 1394

  Fly    87 --------------------------------------CVTCRCGLINTLY--KIVGGQETRVHQ 111
                                                  ..:..||:...:.  :||||:.:....
  Fly  1395 PSDNEIDQGATLSSYGGANGRKIHSTSRTLPTPNLAFHSPSTECGVRPHVKSGRIVGGKGSTFGA 1459

  Fly   112 YPWMAVIL------IYNRFYCSGSLINDLYVLTAAHCVEGVPPELITL--RF-----LEHNRSHS 163
            |||..::.      ::.:..|.|.||...||:|||||..|....|:.:  .|     ||..||  
  Fly  1460 YPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGFLASLVAVMGEFDISGDLESKRS-- 1522

  Fly   164 NDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGIVAG 228
                 :.:.|.||.||..|:|.:|:||||:|.|:.|:....| :.|||:|.....|...:..|.|
  Fly  1523 -----VTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTH-IVPICMPNDVADFTGRMATVTG 1581

  Fly   229 WGAQREGGFGTDTLREVDVVVLPQSECRN--GTTYRPGQITDNMMCAGYISEGGKDACSGDSGGP 291
            ||..:.||.....|:||.|.::..|.|:.  .|.....:|..:.:|||| :.|.||:|.||||||
  Fly  1582 WGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGY-ANGQKDSCEGDSGGP 1645

  Fly   292 LQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSNT 338
            |  ......|:|:|||.||.|:.||.|..||||.|...|..||.|.|
  Fly  1646 L--VLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRSIT 1690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 92/247 (37%)
Tryp_SPc 101..334 CDD:238113 92/247 (37%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 94/250 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457812
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.