DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG8738

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:294 Identity:87/294 - (29%)
Similarity:134/294 - (45%) Gaps:65/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PIER---DCVTCRCGLINT--LYKIVGGQ---ETRVHQYPWMAVIL-IYNRFYCSGSLINDLYVL 137
            ||:|   |.:...||..|.  ||..:.|.   |:...::|||..:: :...|.|.|:||:...||
  Fly   175 PIQRNVKDFLLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVL 239

  Fly   138 TAAHCVEGVPPELITLRFLEHNRSHSNDDIVIQ-----------------RYVSRVKVHELYNPR 185
            |:||.|              .||  |.|.::::                 |.:|.:..||.:|..
  Fly   240 TSAHNV--------------FNR--SEDSLLVRAGDWDLNSQTELHPYQMRAISELHRHENFNNL 288

  Fly   186 SFDNDLAVLRLNQPLDMRHHRLRPICL-PVQSYSFDHELG----IVAGWGAQREGGFGT-----D 240
            :..||:|::.|.:|..:..| ::|||| |.::...:.||.    :..|||.:    :.|     :
  Fly   289 TLYNDIALVVLERPFQVAPH-IQPICLPPPETPQMEAELRSASCLATGWGLR----YSTSRTMEN 348

  Fly   241 TLREVDVVVLPQSEC----RNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPG 301
            .|:.:::..:....|    |:....|...:..:..|||.:.  |||.|.||.|.||..|...|..
  Fly   349 LLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVK--GKDTCMGDGGSPLFCTLPGQKD 411

  Fly   302 QYQLAGIVSWGVGCARPQSPGVYTRVNQYLR-WL 334
            :|||.|:||||:.||....|..||.| .||| |:
  Fly   412 RYQLVGLVSWGIECAEKDVPAAYTNV-AYLRNWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 77/268 (29%)
Tryp_SPc 101..334 CDD:238113 77/268 (29%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 77/262 (29%)
Tryp_SPc 207..444 CDD:214473 76/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.