DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and SPH93

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:312 Identity:99/312 - (31%)
Similarity:151/312 - (48%) Gaps:41/312 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TTTTSTPVVATTSTTTRRTTTTSSTTSRTTTSRTTVANFPIERDCVTCRCGLINTL-YKIVGG-- 104
            ||....|    |:.....||...:.|:......|.|.:    .:.::..||:.|.. .::|.|  
  Fly   192 TTNVGNP----TNNGGNPTTNFGNPTNNGGNPTTNVGS----SELLSPSCGMSNANGLQMVEGIT 248

  Fly   105 -QETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRS-----HS 163
             .:.|..||||...|....::...||||....|||.||.|..:..||:.       |:     .|
  Fly   249 IDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELVV-------RAGDWDLKS 306

  Fly   164 NDDIVI--QRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGIV 226
            :.:|.:  ||.|.|..:||.::.:|..|:||:|.||.|..:..| :|.||||..:.||......|
  Fly   307 DREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDH-IRTICLPTPNKSFAGRRCTV 370

  Fly   227 AGWGAQR-EGGFGTDTLREVDVVVLPQSEC-------RNGTTYRPGQITDNMMCAGYISEGGKDA 283
            ||||..| |....:..|::|.::|:.::.|       |.|..:   ::..|::|||  .|.|:|.
  Fly   371 AGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKF---ELPKNIICAG--GELGRDT 430

  Fly   284 CSGDSGGPLQTTF-DEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            |:||.|..|..:. .|..|.|:.||||:|||||.:...|.:||.|:::..|:
  Fly   431 CTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 86/251 (34%)
Tryp_SPc 101..334 CDD:238113 86/251 (34%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 85/246 (35%)
Tryp_SPc 252..482 CDD:214473 84/242 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457690
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.