DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG5390

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:268 Identity:93/268 - (34%)
Similarity:130/268 - (48%) Gaps:37/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGLIN---TLYKIVG--GQETRVHQYPWMAVIL----IYNRFYCSGSLINDLYVLTAAHCVEGVP 147
            ||..|   ..:||.|  .||....::|||..||    ..|.:.|.|:||....||||||||....
  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199

  Fly   148 PELITLRFLEHN-------RSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHH 205
            |..|.:|..|.:       |.|.:      |||..:..||.:|..|..||:||:.|..|..::.:
  Fly   200 PSSIVVRAGEWDTQTQTEIRRHED------RYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQEN 258

  Fly   206 RLRPICLPVQSYSFDHELGIVAGWGAQREGGFGTD-----TLREVDVVVLPQSECR-NGTTYRPG 264
             ::.:|||.....||.:.....|||..:   ||.|     .|::||:.|:|:.:|. |....|.|
  Fly   259 -IQTVCLPNVGDKFDFDRCYATGWGKNK---FGKDGEYQVILKKVDMPVVPEQQCETNLRETRLG 319

  Fly   265 Q---ITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTR 326
            :   :.|:.:|||  .|..||.|.||.|.||......|..:::.||||:||:||.....||||..
  Fly   320 RHFILHDSFICAG--GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYAS 382

  Fly   327 VNQYLRWL 334
            |.:...|:
  Fly   383 VAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 89/254 (35%)
Tryp_SPc 101..334 CDD:238113 88/254 (35%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 87/250 (35%)
Tryp_SPc 153..390 CDD:214473 86/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.