DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG3355

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:258 Identity:119/258 - (46%)
Similarity:172/258 - (66%) Gaps:14/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CRCGLINTLYKIVGGQETRVHQYPWMAVIL---IYNRFYCSGSLINDLYVLTAAHCVEGVPPELI 151
            |.||..| :.:|||||:.|.::|||.|.::   .|.|.:|.||||||.|||||||||.| ..:.|
  Fly    66 CFCGTPN-VNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHG-NRDQI 128

  Fly   152 TLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQS 216
            |:|.|:.:||..:..||  |.|.:..||..|:|....||:|:|:|..|:.:..: :||:|||..:
  Fly   129 TIRLLQIDRSSRDPGIV--RKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGN-MRPVCLPEAN 190

  Fly   217 YSFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGK 281
            ::||.:..:|||||..:|||..::.|:||:|.|:..::||. |.|: .:|.:.|:|||.:.:|||
  Fly   191 HNFDGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQ-TRYK-DKIAEVMLCAGLVQQGGK 253

  Fly   282 DACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSNTPGGCHC 344
            |||.|||||||..    ..|:|:|||:||:|.|||:..:||||.||:::|.|:..||..||:|
  Fly   254 DACQGDSGGPLIV----NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTADGCYC 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 109/235 (46%)
Tryp_SPc 101..334 CDD:238113 109/235 (46%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 109/236 (46%)
Tryp_SPc 76..305 CDD:238113 110/238 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471765
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 1 0.900 - - E33208_3BJ04
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
109.900

Return to query results.
Submit another query.