DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG40160

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:273 Identity:84/273 - (30%)
Similarity:124/273 - (45%) Gaps:48/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGLINTLYKIVGG----------QETRVHQYPWMAVILIYN---RFYCSGSLINDLYVLTAAHCV 143
            ||:.||     ||          .|....::|| .|.|:::   .::|:||||:...||||||||
  Fly   151 CGVRNT-----GGLDFTLSGVSQNEAGFGEFPW-TVALLHSGNLSYFCAGSLIHKQVVLTAAHCV 209

  Fly   144 EGVPPELITLRFLEHNRSHSNDDIVIQ-RYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRL 207
            |.:.....|:|..|.:.....:.:..| |.|..|.:|..||.||...|.|::.|:||:.:..| :
  Fly   210 ESLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDH-I 273

  Fly   208 RPICLPVQS---------YSFDHELGIVAGWGAQREGGFG--TDTLREVDVVVLPQSECR---NG 258
            ..||||.|.         :|        .|||....|..|  :..::.|.:.::..:.|:   .|
  Fly   274 NVICLPQQDDIPQPGNTCFS--------TGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRG 330

  Fly   259 TTYRPGQITD-NMMCAGYISEGGKDACSGDSGGPLQ-TTFDEQPGQYQLAGIVSWGVGCARPQSP 321
            |...|....| :.:|||  .:.|.|.|.||.|.||. .....:..:||..|||:||:|| ..:.|
  Fly   331 TRLGPKFALDRSFICAG--GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGC-NDEVP 392

  Fly   322 GVYTRVNQYLRWL 334
            ..|..|.....|:
  Fly   393 AAYANVALVRGWI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 79/262 (30%)
Tryp_SPc 101..334 CDD:238113 79/262 (30%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 78/253 (31%)
Tryp_SPc 169..405 CDD:214473 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.