DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and prss60.3

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:265 Identity:100/265 - (37%)
Similarity:138/265 - (52%) Gaps:31/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGL--INTLYKIVGGQETRVHQYPWMAVILI--YNRFYCSGSLINDLYVLTAAHCVEGVPPELIT 152
            ||.  :||  :||||.......:||...:..  |...:|.||||:..:|||||||:.|| .|...
Zfish    27 CGQAPLNT--RIVGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGV-SETTL 88

  Fly   153 LRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQS- 216
            :.:|........:.....|.|::..||..||..:.|||:|:|||:..:...:: :||:||..|: 
Zfish    89 VVYLGRRTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNY-IRPVCLAAQNS 152

  Fly   217 -YSFDHELGIVAGWGAQREG------GFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAG 274
             ||.... ..:.|||..:.|      |.    |:|..:.|:....|  ......|.:|:||:|||
Zfish   153 VYSAGTS-SWITGWGDIQAGVNLPAPGI----LQETMIPVVANDRC--NALLGSGTVTNNMICAG 210

  Fly   275 YISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGS--- 336
             :::||||.|.||||||:.|....   .:..|||.|||.|||.|.||||||||:||..|:.|   
Zfish   211 -LTQGGKDTCQGDSGGPMVTRLCT---VWVQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKIS 271

  Fly   337 -NTPG 340
             |.||
Zfish   272 LNKPG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 91/242 (38%)
Tryp_SPc 101..334 CDD:238113 91/242 (38%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 92/245 (38%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587879
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.