DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG18557

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:341 Identity:86/341 - (25%)
Similarity:144/341 - (42%) Gaps:82/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TTTTTSTPV----------VATTSTTTRRTTTTSSTTSRTT----TSRTTVANFPIERDCVTCRC 92
            |.|.|..|.          :..||...:...:..|...|:.    :|:..|...|:       .|
  Fly    14 TLTETGAPCGLQMECVPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLVIGAPL-------NC 71

  Fly    93 GLIN------TLYKIVGGQETRVHQYPWMAVILIYN--RFYCSGSLINDLYVLTAAHCVEGVPPE 149
            |..|      |:.::|  .:.:.:::|| .|.|:.|  .|:.:|:|:.:..|:||||        
  Fly    72 GKSNPNGLGGTVEEVV--DQAKPNEFPW-TVALMQNLINFFGAGTLVTENIVITAAH-------- 125

  Fly   150 LITLRFLEHNRSHSNDDIV-------------IQ-RYVSRVKVHELYNPRSFDNDLAVLRLNQPL 200
                  |..:::.::..|:             || |..:|:..|..:|..:..|::|::.|....
  Fly   126 ------LMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSF 184

  Fly   201 DMRHHRLRPICLPVQSYSFDHELGIVAGWGAQREGGFGTDTL--------REVDVVVLPQSEC-- 255
            .|: ..:.|||.|....|||.|..:|||||.       .|.|        :::|:.::.:|:|  
  Fly   185 VMK-PPIGPICWPTSGVSFDRERCLVAGWGR-------PDFLAKNYSYKQKKIDLPIVSRSDCES 241

  Fly   256 --RNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARP 318
              |.....:..|:...::|||  .|.|:|||.||.|.||.......|..|:|.|||:.|..|...
  Fly   242 LLRRTAFVQSFQLDPTILCAG--GERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLE 304

  Fly   319 QSPGVYTRVNQYLRWL 334
            ..|.:||.::....|:
  Fly   305 NVPALYTNISHMRPWI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 70/260 (27%)
Tryp_SPc 101..334 CDD:238113 70/260 (27%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 70/258 (27%)
Tryp_SPc 90..320 CDD:214473 69/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.