DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG14227

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:251 Identity:65/251 - (25%)
Similarity:102/251 - (40%) Gaps:47/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCV--EGVPPELITLRFLEHNRSHSNDDIVI 169
            |.:...||:..:::..:..|||||||..:||||||||  |.:...|.........::.|:...:.
  Fly    51 TDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLS 115

  Fly   170 QRYVSRVK---VHELYNP-RSFDNDLAVLRLNQPLDMRHHRLRPICL----PVQSYSFDHELGIV 226
            ..|..|:.   ||..:.. ::...|:.:||:...:..... :|||||    ||.:.. ..:|.: 
  Fly   116 NAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDF-VRPICLLINEPVAAID-RFQLTV- 177

  Fly   227 AGWGAQREG----------GFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGK 281
              ||...|.          ..|....||:..:...|            |:.::.:|   :.....
  Fly   178 --WGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQ------------QVDESQIC---VHTETS 225

  Fly   282 DACSGDSGGPLQTTFDEQPGQYQL--AGIVSWGV-GCARPQSPGVYTRVNQYLRWL 334
            .||.||||||..... ...|.|:.  .||:.:|: .||   ...|.|.|..|:.|:
  Fly   226 HACKGDSGGPFSAKI-LYGGTYRTFQFGIIIFGLSSCA---GLSVCTNVTFYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 64/248 (26%)
Tryp_SPc 101..334 CDD:238113 64/249 (26%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/243 (26%)
Tryp_SPc 57..277 CDD:238113 63/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.