DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG4653

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:232 Identity:63/232 - (27%)
Similarity:101/232 - (43%) Gaps:49/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 CSGSLINDLYVLTAAHCV------EGVPPELITLRFLEHNRSHSNDDIVIQRY-------VSRVK 177
            |.|:||.:.::|||||||      :..|.:...:|...           |||.       :|::.
  Fly    50 CGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGS-----------IQRLTGGQLVPLSKII 103

  Fly   178 VHELYNPRSFD----NDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGIVAGWGAQREGGFG 238
            :|..|:  |.|    ||||:|.|...: :.:....||.|..:..:...:: |.:|||:.:..|..
  Fly   104 IHTNYS--SSDAVGSNDLALLELETSV-VLNANTNPIDLATERPAAGSQI-IFSGWGSSQVDGSL 164

  Fly   239 TDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQY 303
            :..|:......|..|:|:.....:    .::::|...:.|.....||||:|.         |..|
  Fly   165 SHVLQVATRQSLSASDCQTELYLQ----QEDLLCLSPVDEDFAGLCSGDAGA---------PASY 216

  Fly   304 --QLAGIVSWGV-GCARPQSPGVYTRVNQYLRWLGSN 337
              ||.||.::.| ||...|..| |..|.|:|.|:..|
  Fly   217 NNQLVGIAAFFVSGCGSEQPDG-YVDVTQHLEWINEN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 61/226 (27%)
Tryp_SPc 101..334 CDD:238113 61/227 (27%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 62/230 (27%)
Tryp_SPc 30..249 CDD:214473 61/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.