DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG9676

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:265 Identity:80/265 - (30%)
Similarity:123/265 - (46%) Gaps:47/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VTCRCGLI---NTLY--KIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVP 147
            |.|..|::   :::.  :||||.:.|..|:|....:.......|.||:|:..||:||||||:   
  Fly    10 VLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK--- 71

  Fly   148 PELITLRFLEHNRSHSNDDIVIQR------------YVSRVKVHELYNPRSFDNDLAVLRLNQPL 200
                     :.|.....:::.||.            .|:.|.||..||  |..:|:|||||...|
  Fly    72 ---------QGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSL 125

  Fly   201 DMRHHRLRPICLPVQSYSFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQ 265
            .. :..:..|.|..:....|..:.| :||||..:.|..:::|..|.|..|.:..|:.  ||. .|
  Fly   126 TF-NSNIAAIKLATEDPPNDATVDI-SGWGAISQRGPISNSLLYVQVKALSRESCQK--TYL-RQ 185

  Fly   266 ITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGV-GCARPQSPGVYTRVNQ 329
            :.:..||  .:....|.||.||||||  .|:     |.:|.|:.|:.: ||.| .:|..|.||::
  Fly   186 LPETTMC--LLHPKDKGACYGDSGGP--ATY-----QGKLVGLASFVIGGCGR-AAPDGYERVSK 240

  Fly   330 YLRWL 334
            ...|:
  Fly   241 LRNWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 76/245 (31%)
Tryp_SPc 101..334 CDD:238113 76/245 (31%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/246 (31%)
Tryp_SPc 28..248 CDD:238113 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457772
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.