DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and f2

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_005169022.1 Gene:f2 / 325881 ZFINID:ZDB-GENE-030131-4606 Length:635 Species:Danio rerio


Alignment Length:267 Identity:91/267 - (34%)
Similarity:133/267 - (49%) Gaps:49/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KIVGGQETRVHQYPWMAVILIYNR----FYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNR 160
            :||||.|..|...||.  :::|.|    ..|..|||:|.::||||||:. .||         .|:
Zfish   373 RIVGGDEAEVASAPWQ--VMLYKRSPQELLCGASLISDEWILTAAHCIL-YPP---------WNK 425

  Fly   161 SHSNDDIVIQ-------RY---------VSRVKVHELYN-PRSFDNDLAVLRLNQPLDMRHHRLR 208
            :.:.:||:::       :|         :..:.||..|| ..:.:.|:|:|.:.:|: :....:.
Zfish   426 NFTINDIIVRLGKHSRTKYERGIEKIVAIDEIIVHPKYNWKENLNRDIALLHMKKPV-VFTSEIH 489

  Fly   209 PICLPVQSYS----FDHELGIVAGWGAQREGGFGTDT-----LREVDVVVLPQSECRNGTTYRPG 264
            |:|||.:|.:    |....|.|.|||..||......|     |:::.:.::.||.|||.|:.   
Zfish   490 PVCLPTKSIAKNLMFAGYKGRVTGWGNLRESWTSNPTNLPTVLQQIHLPIVDQSICRNSTSV--- 551

  Fly   265 QITDNMMCAGYISEGGK--DACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRV 327
            .|||||.||||..:..|  |||.||||||...........||: ||||||.||.|....|.||.:
Zfish   552 IITDNMFCAGYQPDDSKRGDACEGDSGGPFVMKSPSDNRWYQI-GIVSWGEGCDRDGKYGFYTHL 615

  Fly   328 NQYLRWL 334
            .:..||:
Zfish   616 FRMRRWM 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 89/264 (34%)
Tryp_SPc 101..334 CDD:238113 90/264 (34%)
f2XP_005169022.1 GLA 39..100 CDD:214503
KR 126..206 CDD:214527
KR 228..309 CDD:214527
Thrombin_light 326..373 CDD:286482 91/267 (34%)
Tryp_SPc 373..621 CDD:214473 89/264 (34%)
Tryp_SPc 374..625 CDD:238113 91/266 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.