DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and HPN

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:366 Identity:108/366 - (29%)
Similarity:155/366 - (42%) Gaps:86/366 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LCSGSTERRIRPNEGKIFEWLGSILLPSTTTTTSTPVVATTSTTTRRTTTTSSTTSRTTTSRTTV 78
            |||..:..|:   .|...|.:|.:                      |..|.|....||..:..|.
Human    76 LCSSRSNARV---AGLSCEEMGFL----------------------RALTHSELDVRTAGANGTS 115

  Fly    79 ANFPIER----------------DC-------VTCR-CGLIN-TLYKIVGGQETRVHQYPWMAVI 118
            ..|.::.                ||       ..|: ||... .:.:||||::|.:.::||...:
Human   116 GFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL 180

  Fly   119 LIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRSHSNDDIV-----------IQRY 172
            .......|.|||::..:|||||||            |.|.||..|...:.           :|..
Human   181 RYDGAHLCGGSLLSGDWVLTAAHC------------FPERNRVLSRWRVFAGAVAQASPHGLQLG 233

  Fly   173 VSRVKVHELY------NPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSF-DHELGIVAGWG 230
            |..|..|..|      |.....||:|::.|:.||.:..: ::|:|||....:. |.::..|.|||
Human   234 VQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEY-IQPVCLPAAGQALVDGKICTVTGWG 297

  Fly   231 AQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPL--Q 293
            ..:..|.....|:|..|.::....| ||..:...||...|.|||| .|||.|||.||||||.  :
Human   298 NTQYYGQQAGVLQEARVPIISNDVC-NGADFYGNQIKPKMFCAGY-PEGGIDACQGDSGGPFVCE 360

  Fly   294 TTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            .:....| :::|.||||||.|||..|.|||||:|:.:..|:
Human   361 DSISRTP-RWRLCGIVSWGTGCALAQKPGVYTKVSDFREWI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 88/252 (35%)
Tryp_SPc 101..334 CDD:238113 88/252 (35%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275 19/107 (18%)
Tryp_SPc 163..400 CDD:238113 88/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8579
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.