DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Tmprss11g

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_796136.2 Gene:Tmprss11g / 320454 MGIID:2444058 Length:417 Species:Mus musculus


Alignment Length:241 Identity:80/241 - (33%)
Similarity:127/241 - (52%) Gaps:12/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVP-PELITLRFLEHNRSHS 163
            :|..|:......:||.:.:.:.....|..|||...:::|:|||.:... |:|.|:.|   .|:.|
Mouse   185 RIADGKPADKASWPWQSSLQVEGIHLCGASLIGSQWLVTSAHCFDNYKNPKLWTVSF---GRTLS 246

  Fly   164 NDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYS-FDHELGIVA 227
            :.  :..|.|..:.|||.|.....|:|:||::|:.|: :....|..:|||..::. .......|.
Mouse   247 SP--LTTRKVESIIVHENYASHKHDDDIAVVKLSSPV-LFSENLHRVCLPDATFQVLPKSKVFVT 308

  Fly   228 GWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPL 292
            ||||.:..|...::|:||::.::....|.....| .|.|:..|:|||::: |..|||.|||||||
Mouse   309 GWGALKANGPFPNSLQEVEIEIISNDVCNQVNVY-GGAISSGMICAGFLT-GKLDACEGDSGGPL 371

  Fly   293 QTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSNT 338
              ...:...::.|.||||||:.|.:...||:||||..|..|:.|.|
Mouse   372 --VISDNRNKWYLLGIVSWGIDCGKENKPGIYTRVTHYRDWIKSKT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 77/234 (33%)
Tryp_SPc 101..334 CDD:238113 77/234 (33%)
Tmprss11gNP_796136.2 SEA 48..142 CDD:279699
Tryp_SPc 185..411 CDD:214473 77/235 (33%)
Tryp_SPc 186..414 CDD:238113 78/237 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.